Cart 22 Product Products 6 099,71 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Phospho-IG...259,07 € -
1 x Dynactin 2...259,07 € -
-
-
No products
To be determined Shipping
6 099,71 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 22 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 6 099,71 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 6 099,71 €
Data sheet of PRKACA polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about PRKACA polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00005566-A01 |
| Product name: | PRKACA polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant PRKACA. |
| Gene id: | 5566 |
| Gene name: | PRKACA |
| Gene alias: | MGC102831|MGC48865|PKACA |
| Gene description: | protein kinase, cAMP-dependent, catalytic, alpha |
| Genbank accession: | BC039846 |
| Immunogen: | PRKACA (AAH39846, 1 a.a. ~ 120 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV |
| Protein accession: | AAH39846 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (39.31 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Visual screening and analysis for kinase-regulated membrane trafficking pathways that are involved in extensive beta-amyloid secretion.Adachi A, Kano F, Saido TC, Murata M. Genes Cells. 2009 Mar;14(3):355-69. Epub 2009 Feb 13. |