Brand: | Abnova |
Reference: | H00005566-A01 |
Product name: | PRKACA polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant PRKACA. |
Gene id: | 5566 |
Gene name: | PRKACA |
Gene alias: | MGC102831|MGC48865|PKACA |
Gene description: | protein kinase, cAMP-dependent, catalytic, alpha |
Genbank accession: | BC039846 |
Immunogen: | PRKACA (AAH39846, 1 a.a. ~ 120 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV |
Protein accession: | AAH39846 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (39.31 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Visual screening and analysis for kinase-regulated membrane trafficking pathways that are involved in extensive beta-amyloid secretion.Adachi A, Kano F, Saido TC, Murata M. Genes Cells. 2009 Mar;14(3):355-69. Epub 2009 Feb 13. |