View larger

PRKACA polyclonal antibody (A01)

Reference:

Condition: New product

Data sheet of PRKACA polyclonal antibody (A01)

Brand:	Abnova
Reference:	H00005566-A01
Product name:	PRKACA polyclonal antibody (A01)
Product description:	Mouse polyclonal antibody raised against a partial recombinant PRKACA.
Gene id:	5566
Gene name:	PRKACA
Gene alias:	MGC102831\|MGC48865\|PKACA
Gene description:	protein kinase, cAMP-dependent, catalytic, alpha
Genbank accession:	BC039846
Immunogen:	PRKACA (AAH39846, 1 a.a. ~ 120 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence:	MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
Protein accession:	AAH39846
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (39.31 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Applications:	ELISA,WB-Re
Shipping condition:	Dry Ice
Publications:	Visual screening and analysis for kinase-regulated membrane trafficking pathways that are involved in extensive beta-amyloid secretion.Adachi A, Kano F, Saido TC, Murata M. Genes Cells. 2009 Mar;14(3):355-69. Epub 2009 Feb 13.