PRKAA1 (Human) Recombinant Protein (Q01) View larger

PRKAA1 (Human) Recombinant Protein (Q01)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PRKAA1 (Human) Recombinant Protein (Q01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about PRKAA1 (Human) Recombinant Protein (Q01)

Brand: Abnova
Reference: H00005562-Q01
Product name: PRKAA1 (Human) Recombinant Protein (Q01)
Product description: Human PRKAA1 partial ORF ( AAH12622, 451 a.a. - 550 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 5562
Gene name: PRKAA1
Gene alias: AMPK|AMPKa1|MGC33776|MGC57364
Gene description: protein kinase, AMP-activated, alpha 1 catalytic subunit
Genbank accession: NM_006251
Immunogen sequence/protein sequence: LQLYQVDSRTYLLDFRSIDDEITEAKSGTATPQRSGSVSNYRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPGSHTIEFFEMCANLIKILAQ
Protein accession: AAH12622
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00005562-Q01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: The PLAG1-GDH1 Axis Promotes Anoikis Resistance and Tumor Metastasis through CamKK2-AMPK Signaling in LKB1-Deficient Lung Cancer.Jin L, Chun J, Pan C, Kumar A, Zhang G, Ha Y, Li D, Alesi GN, Kang Y, Zhou L, Yu WM, Magliocca KR, Khuri FR, Qu CK, Metallo C, Owonikoko TK, Kang S.
Mol Cell. 2018 Jan 4;69(1):87-99.e7. doi: 10.1016/j.molcel.2017.11.025. Epub 2017 Dec 14.

Reviews

Buy PRKAA1 (Human) Recombinant Protein (Q01) now

Add to cart