| Brand: | Abnova |
| Reference: | H00005562-Q01 |
| Product name: | PRKAA1 (Human) Recombinant Protein (Q01) |
| Product description: | Human PRKAA1 partial ORF ( AAH12622, 451 a.a. - 550 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 5562 |
| Gene name: | PRKAA1 |
| Gene alias: | AMPK|AMPKa1|MGC33776|MGC57364 |
| Gene description: | protein kinase, AMP-activated, alpha 1 catalytic subunit |
| Genbank accession: | NM_006251 |
| Immunogen sequence/protein sequence: | LQLYQVDSRTYLLDFRSIDDEITEAKSGTATPQRSGSVSNYRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPGSHTIEFFEMCANLIKILAQ |
| Protein accession: | AAH12622 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quality control testing picture: |  |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Product type: | Proteins |
| Host species: | Wheat Germ (in vitro) |
| Antigen species / target species: | Human |
| Applications: | AP,Array,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | The PLAG1-GDH1 Axis Promotes Anoikis Resistance and Tumor Metastasis through CamKK2-AMPK Signaling in LKB1-Deficient Lung Cancer.Jin L, Chun J, Pan C, Kumar A, Zhang G, Ha Y, Li D, Alesi GN, Kang Y, Zhou L, Yu WM, Magliocca KR, Khuri FR, Qu CK, Metallo C, Owonikoko TK, Kang S. Mol Cell. 2018 Jan 4;69(1):87-99.e7. doi: 10.1016/j.molcel.2017.11.025. Epub 2017 Dec 14. |