| Brand: | Abnova |
| Reference: | H00005562-M01 |
| Product name: | PRKAA1 monoclonal antibody (M01), clone 1G4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PRKAA1. |
| Clone: | 1G4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5562 |
| Gene name: | PRKAA1 |
| Gene alias: | AMPK|AMPKa1|MGC33776|MGC57364 |
| Gene description: | protein kinase, AMP-activated, alpha 1 catalytic subunit |
| Genbank accession: | NM_006251 |
| Immunogen: | PRKAA1 (AAH12622, 451 a.a. ~ 550 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LQLYQVDSRTYLLDFRSIDDEITEAKSGTATPQRSGSVSNYRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPGSHTIEFFEMCANLIKILAQ |
| Protein accession: | AAH12622 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PRKAA1 monoclonal antibody (M01), clone 1G4 Western Blot analysis of PRKAA1 expression in HepG2 ( Cat # L019V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |