| Brand: | Abnova |
| Reference: | H00005552-M03 |
| Product name: | SRGN monoclonal antibody (M03), clone 1D8 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant SRGN. |
| Clone: | 1D8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5552 |
| Gene name: | SRGN |
| Gene alias: | FLJ12930|MGC9289|PPG|PRG|PRG1 |
| Gene description: | serglycin |
| Genbank accession: | BC015516 |
| Immunogen: | SRGN (AAH15516, 1 a.a. ~ 158 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MMQKLLKCSRLVLALALILVLESSVQGYPTQRARYQWVRCNPDSNSANCLEEKGPMFELLPGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDYQLVDESDAFHDNLRSLDRNLPSDSQDLGQHGLEEDFML |
| Protein accession: | AAH15516 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (43.12 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged SRGN is 0.3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Serglycin secretion is part of the inflammatory response in activated primary human endothelial cells in vitro.Reine TM, Vuong TT, Jenssen TG, Kolset SO Biochim Biophys Acta. 2014 Feb 7. pii: S0304-4165(14)00048-8. doi: 10.1016/j.bbagen.2014.02.002. |