No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Rat |
Host species | Mouse |
Applications | WB-Ti,IF,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00005534-M01 |
Product name: | PPP3R1 monoclonal antibody (M01), clone 4E1 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant PPP3R1. |
Clone: | 4E1 |
Isotype: | IgG1 Kappa |
Gene id: | 5534 |
Gene name: | PPP3R1 |
Gene alias: | CALNB1|CNB|CNB1 |
Gene description: | protein phosphatase 3 (formerly 2B), regulatory subunit B, alpha isoform |
Genbank accession: | BC027913 |
Immunogen: | PPP3R1 (AAH27913, 1 a.a. ~ 170 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV |
Protein accession: | AAH27913 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (44.44 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: | ![]() |
Application image note: | Immunofluorescence of monoclonal antibody to PPP3R1 on HeLa cell. [antibody concentration 25 ug/ml] |
Applications: | WB-Ti,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Placenta-specific miRNA (miR-512-3p) targets PPP3R1 encoding the calcineurin B regulatory subunit in BeWo cells.Kurashina R, Kikuchi K, Iwaki J, Yoshitake H, Takeshita T, Takizawa T J Obstet Gynaecol Res. 2014 Mar;40(3):650-60. doi: 10.1111/jog.12217. Epub 2013 Nov 18. |