Cart 9 Product Products 2 656,29 € (empty)
No products
To be determined Shipping
2 656,29 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 9 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 2 656,29 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 2 656,29 €
Data sheet of PPP3CA polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about PPP3CA polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00005530-A01 |
| Product name: | PPP3CA polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant PPP3CA. |
| Gene id: | 5530 |
| Gene name: | PPP3CA |
| Gene alias: | CALN|CALNA|CALNA1|CCN1|CNA1|PPP2B |
| Gene description: | protein phosphatase 3 (formerly 2B), catalytic subunit, alpha isoform |
| Genbank accession: | NM_000944 |
| Immunogen: | PPP3CA (NP_000935, 1 a.a. ~ 84 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAP |
| Protein accession: | NP_000935 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.35 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PPP3CA polyclonal antibody (A01), Lot # 051207JC01 Western Blot analysis of PPP3CA expression in 293 ( Cat # L026V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |