View larger

PPP3CA polyclonal antibody (A01)

Reference:

Condition: New product

Data sheet of PPP3CA polyclonal antibody (A01)

Brand:	Abnova
Reference:	H00005530-A01
Product name:	PPP3CA polyclonal antibody (A01)
Product description:	Mouse polyclonal antibody raised against a partial recombinant PPP3CA.
Gene id:	5530
Gene name:	PPP3CA
Gene alias:	CALN\|CALNA\|CALNA1\|CCN1\|CNA1\|PPP2B
Gene description:	protein phosphatase 3 (formerly 2B), catalytic subunit, alpha isoform
Genbank accession:	NM_000944
Immunogen:	PPP3CA (NP_000935, 1 a.a. ~ 84 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence:	MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESVALRIITEGASILRQEKNLLDIDAP
Protein accession:	NP_000935
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (35.35 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	PPP3CA polyclonal antibody (A01), Lot # 051207JC01 Western Blot analysis of PPP3CA expression in 293 ( Cat # L026V1 ).
Applications:	WB-Ce,ELISA,WB-Re
Shipping condition:	Dry Ice