No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Tr,PLA-Ce |
Brand: | Abnova |
Reference: | H00005527-M01 |
Product name: | PPP2R5C monoclonal antibody (M01), clone 3G9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PPP2R5C. |
Clone: | 3G9 |
Isotype: | IgG2a Kappa |
Gene id: | 5527 |
Gene name: | PPP2R5C |
Gene alias: | B56G|MGC23064|PR61G |
Gene description: | protein phosphatase 2, regulatory subunit B', gamma isoform |
Genbank accession: | NM_002719 |
Immunogen: | PPP2R5C (NP_002710.2, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MLTCNKAGSRMVVDAANSNGPFQPVVLLHIRDVPPADQEKLFIQKLRQCCVLFDFVSDPLSDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFA |
Protein accession: | NP_002710.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged PPP2R5C is approximately 3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Tr,PLA-Ce |
Shipping condition: | Dry Ice |