PPP2R4 purified MaxPab mouse polyclonal antibody (B01P) View larger

PPP2R4 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PPP2R4 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about PPP2R4 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00005524-B01P
Product name: PPP2R4 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human PPP2R4 protein.
Gene id: 5524
Gene name: PPP2R4
Gene alias: MGC2184|PP2A|PR53|PTPA
Gene description: protein phosphatase 2A activator, regulatory subunit 4
Genbank accession: NM_021131.3
Immunogen: PPP2R4 (NP_066954.2, 1 a.a. ~ 323 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAEGERQPPPDSSEEAPPATQNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTSG
Protein accession: NP_066954.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005524-B01P-13-15-1.jpg
Application image note: Western Blot analysis of PPP2R4 expression in transfected 293T cell line (H00005524-T01) by PPP2R4 MaxPab polyclonal antibody.

Lane 1: PPP2R4 transfected lysate(35.53 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PPP2R4 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart