Brand: | Abnova |
Reference: | H00005524-A01 |
Product name: | PPP2R4 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant PPP2R4. |
Gene id: | 5524 |
Gene name: | PPP2R4 |
Gene alias: | MGC2184|PP2A|PR53|PTPA |
Gene description: | protein phosphatase 2A activator, regulatory subunit 4 |
Genbank accession: | NM_021131 |
Immunogen: | PPP2R4 (NP_066954, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | QNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLV |
Protein accession: | NP_066954 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | PPP2R4 polyclonal antibody (A01), Lot # 051212JC01 Western Blot analysis of PPP2R4 expression in HL-60 ( Cat # L014V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |