PPP2R4 polyclonal antibody (A01) View larger

PPP2R4 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PPP2R4 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about PPP2R4 polyclonal antibody (A01)

Brand: Abnova
Reference: H00005524-A01
Product name: PPP2R4 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant PPP2R4.
Gene id: 5524
Gene name: PPP2R4
Gene alias: MGC2184|PP2A|PR53|PTPA
Gene description: protein phosphatase 2A activator, regulatory subunit 4
Genbank accession: NM_021131
Immunogen: PPP2R4 (NP_066954, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: QNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLV
Protein accession: NP_066954
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005524-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005524-A01-1-2-1.jpg
Application image note: PPP2R4 polyclonal antibody (A01), Lot # 051212JC01 Western Blot analysis of PPP2R4 expression in HL-60 ( Cat # L014V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PPP2R4 polyclonal antibody (A01) now

Add to cart