| Brand: | Abnova |
| Reference: | H00005524-A01 |
| Product name: | PPP2R4 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant PPP2R4. |
| Gene id: | 5524 |
| Gene name: | PPP2R4 |
| Gene alias: | MGC2184|PP2A|PR53|PTPA |
| Gene description: | protein phosphatase 2A activator, regulatory subunit 4 |
| Genbank accession: | NM_021131 |
| Immunogen: | PPP2R4 (NP_066954, 21 a.a. ~ 120 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | QNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRVSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLV |
| Protein accession: | NP_066954 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PPP2R4 polyclonal antibody (A01), Lot # 051212JC01 Western Blot analysis of PPP2R4 expression in HL-60 ( Cat # L014V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |