| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00005514-M02 |
| Product name: | PPP1R10 monoclonal antibody (M02), clone 1D6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PPP1R10. |
| Clone: | 1D6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5514 |
| Gene name: | PPP1R10 |
| Gene alias: | CAT53|FB19|PNUTS|PP1R10 |
| Gene description: | protein phosphatase 1, regulatory (inhibitor) subunit 10 |
| Genbank accession: | NM_002714 |
| Immunogen: | PPP1R10 (NP_002705.2, 1 a.a. ~ 83 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MGSGPIDPKELLKGLDSFLNRDGEVKSVDGISKIFSLMKEARKMVSRCTYLNILLQTRSPEILVKFIDVGGYKLLNNWLTYSK |
| Protein accession: | NP_002705.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.87 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of PPP1R10 expression in transfected 293T cell line by PPP1R10 monoclonal antibody (M02), clone 1D6. Lane 1: PPP1R10 transfected lysate(99.1 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |