No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse,Rat |
Host species | Mouse |
Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00005511-M21 |
Product name: | PPP1R8 monoclonal antibody (M21), clone 1G11 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant PPP1R8. |
Clone: | 1G11 |
Isotype: | IgG1 Kappa |
Gene id: | 5511 |
Gene name: | PPP1R8 |
Gene alias: | ARD-1|ARD1|NIPP-1|NIPP1|PRO2047 |
Gene description: | protein phosphatase 1, regulatory (inhibitor) subunit 8 |
Genbank accession: | BC013360 |
Immunogen: | PPP1R8 (AAH13360, 1 a.a. ~ 209 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MGGEDDELKGLLGLPEEETELDNLTEFNTAHNKRISTLTIEEGNLDIQRPKRMRKNSRVTFSEDDEIINPEDVDPSVGRFRNMVQTAVVPVKKKRVEGPGSLGLEESGSRRMQNFAFSGGLYGGLPPTHSEAGSQPHGIHGTALIGGLPMPYPNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLLI |
Protein accession: | AAH13360 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (48.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: | ![]() |
Application image note: | PPP1R8 monoclonal antibody (M21), clone 1G11. Western Blot analysis of PPP1R8 expression in Hela S3 NE(Cat # L013V3 ). |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |