PPP1R7 purified MaxPab mouse polyclonal antibody (B02P) View larger

PPP1R7 purified MaxPab mouse polyclonal antibody (B02P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PPP1R7 purified MaxPab mouse polyclonal antibody (B02P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Ti,WB-Tr

More info about PPP1R7 purified MaxPab mouse polyclonal antibody (B02P)

Brand: Abnova
Reference: H00005510-B02P
Product name: PPP1R7 purified MaxPab mouse polyclonal antibody (B02P)
Product description: Mouse polyclonal antibody raised against a full-length human PPP1R7 protein.
Gene id: 5510
Gene name: PPP1R7
Gene alias: SDS22
Gene description: protein phosphatase 1, regulatory (inhibitor) subunit 7
Genbank accession: BC000910.2
Immunogen: PPP1R7 (AAH00910.1, 1 a.a. ~ 360 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAAERGAGQQQSQEMMEVDRRVESEESGDEEGKKHSSGIVADLSEQSLKDGEERGEEDPEEEHELPVDMETINLDRDAEDVDLNHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRNIEGVDKLTRLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLSHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDATFVRF
Protein accession: AAH00910.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005510-B02P-13-15-1.jpg
Application image note: Western Blot analysis of PPP1R7 expression in transfected 293T cell line (H00005510-T02) by PPP1R7 MaxPab polyclonal antibody.

Lane 1: PPP1R7 transfected lysate(39.71 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PPP1R7 purified MaxPab mouse polyclonal antibody (B02P) now

Add to cart