PPP1R7 purified MaxPab mouse polyclonal antibody (B01P) View larger

PPP1R7 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PPP1R7 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,IF,WB-Tr

More info about PPP1R7 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00005510-B01P
Product name: PPP1R7 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human PPP1R7 protein.
Gene id: 5510
Gene name: PPP1R7
Gene alias: SDS22
Gene description: protein phosphatase 1, regulatory (inhibitor) subunit 7
Genbank accession: NM_002712.1
Immunogen: PPP1R7 (NP_002703.1, 1 a.a. ~ 360 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAAERGAGQQQSQEMMEVDRRVESEESGDEEGKKHSSGIVADLSEQSLKDGEERGEEDPEEEHELPVDMETINLDRDAEDVDLNHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRNIEGVDKLTRLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLSHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGARSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDATFVRF
Protein accession: NP_002703.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005510-B01P-13-15-1.jpg
Application image note: Western Blot analysis of PPP1R7 expression in transfected 293T cell line (H00005510-T01) by PPP1R7 MaxPab polyclonal antibody.

Lane 1: PPP1R7 transfected lysate(39.6 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PPP1R7 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart