PPP1CB purified MaxPab mouse polyclonal antibody (B01P) View larger

PPP1CB purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PPP1CB purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about PPP1CB purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00005500-B01P
Product name: PPP1CB purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human PPP1CB protein.
Gene id: 5500
Gene name: PPP1CB
Gene alias: MGC3672|PP-1B|PPP1CD
Gene description: protein phosphatase 1, catalytic subunit, beta isoform
Genbank accession: NM_002709.2
Immunogen: PPP1CB (NP_002700.1, 1 a.a. ~ 327 a.a) full-length human protein.
Immunogen sequence/protein sequence: MADGELNVDSLITRLLEVRGCRPGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR
Protein accession: NP_002700.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005500-B01P-13-15-1.jpg
Application image note: Western Blot analysis of PPP1CB expression in transfected 293T cell line (H00005500-T02) by PPP1CB MaxPab polyclonal antibody.

Lane 1: PPP1CB transfected lysate(35.97 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PPP1CB purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart