PPOX monoclonal antibody (M06), clone 1E1 View larger

PPOX monoclonal antibody (M06), clone 1E1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PPOX monoclonal antibody (M06), clone 1E1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about PPOX monoclonal antibody (M06), clone 1E1

Brand: Abnova
Reference: H00005498-M06
Product name: PPOX monoclonal antibody (M06), clone 1E1
Product description: Mouse monoclonal antibody raised against a partial recombinant PPOX.
Clone: 1E1
Isotype: IgG2a Kappa
Gene id: 5498
Gene name: PPOX
Gene alias: MGC8485|PPO|V290M|VP
Gene description: protoporphyrinogen oxidase
Genbank accession: BC002357
Immunogen: PPOX (AAH02357, 378 a.a. ~ 477 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EASGCVLSQELFQQRAQEAAATQLGLKEMPSHCLVHLHKNCIPQYTLGHWQKLESARQFLTAHRLPLTLAGASYEGVAVNDCIESGRQAAVSVLGTEPNS
Protein accession: AAH02357
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005498-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005498-M06-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged PPOX is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PPOX monoclonal antibody (M06), clone 1E1 now

Add to cart