Brand: | Abnova |
Reference: | H00005496-A01 |
Product name: | PPM1G polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant PPM1G. |
Gene id: | 5496 |
Gene name: | PPM1G |
Gene alias: | MGC1675|MGC2870|PP2CG|PP2CGAMMA|PPP2CG |
Gene description: | protein phosphatase 1G (formerly 2C), magnesium-dependent, gamma isoform |
Genbank accession: | NM_177983 |
Immunogen: | PPM1G (NP_817092, 462 a.a. ~ 544 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | QRDENGELRLLSSIVEELLDQCLAPDTSGDGTGCDNMTCIIICFKPRNTAELQPESGKRKLEEVLSTEGAEENGNSDKKKKAK |
Protein accession: | NP_817092 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.24 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |