Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PPBP monoclonal antibody (M01), clone 3B9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
More info about PPBP monoclonal antibody (M01), clone 3B9
| Brand: | Abnova |
| Reference: | H00005473-M01 |
| Product name: | PPBP monoclonal antibody (M01), clone 3B9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PPBP. |
| Clone: | 3B9 |
| Isotype: | IgG2b Kappa |
| Gene id: | 5473 |
| Gene name: | PPBP |
| Gene alias: | B-TG1|Beta-TG|CTAP-III|CTAP3|CTAPIII|CXCL7|LA-PF4|LDGF|MDGF|NAP-2|PBP|SCYB7|TC1|TC2|TGB|TGB1|THBGB|THBGB1 |
| Gene description: | pro-platelet basic protein (chemokine (C-X-C motif) ligand 7) |
| Genbank accession: | BC028217 |
| Immunogen: | PPBP (AAH28217, 37 a.a. ~ 128 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD |
| Protein accession: | AAH28217 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.75 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western blot analysis of PPBP over-expressed 293 cell line, cotransfected with PPBP Validated Chimera RNAi ( Cat # H00005473-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with PPBP monoclonal antibody (M01), clone 3B9 (Cat # H00005473-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |