| Brand: | Abnova |
| Reference: | H00005469-M02 |
| Product name: | PPARBP monoclonal antibody (M02), clone 1G3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PPARBP. |
| Clone: | 1G3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 5469 |
| Gene name: | MED1 |
| Gene alias: | CRSP1|CRSP200|DRIP205|DRIP230|MGC71488|PBP|PPARBP|PPARGBP|RB18A|TRAP220|TRIP2 |
| Gene description: | mediator complex subunit 1 |
| Genbank accession: | NM_004774 |
| Immunogen: | PPARBP (NP_004765, 1391 a.a. ~ 1490 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KIIISKHDGGSPSIKAKVTLQKPGESSGEGLRPQMASSKNYGSPLISGSTPKHERGSPSHSKSPAYTPQNLDSESESGSSIAEKSYQNSPSSDDGIRPLP |
| Protein accession: | NP_004765 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged PPARBP is approximately 0.1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |