Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PPARG polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about PPARG polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00005468-A01 |
| Product name: | PPARG polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant PPARG. |
| Gene id: | 5468 |
| Gene name: | PPARG |
| Gene alias: | CIMT1|NR1C3|PPARG1|PPARG2|PPARgamma |
| Gene description: | peroxisome proliferator-activated receptor gamma |
| Genbank accession: | NM_138712 |
| Immunogen: | PPARG (NP_619726, 366 a.a. ~ 475 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | FEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY |
| Protein accession: | NP_619726 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | 7beta-Hydroxy-epiandrosterone-mediated regulation of the prostaglandin synthesis pathway in human peripheral blood monocytes.Mee SL, Hennebert O, Ferrec C, Wulfert E, Morfin R. Steroids. 2008 Oct;73(11):1148-59. Epub 2008 May 14. |