No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ce,WB-Tr |
| Brand: | Abnova |
| Reference: | H00005465-D01P |
| Product name: | PPARA purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human PPARA protein. |
| Gene id: | 5465 |
| Gene name: | PPARA |
| Gene alias: | MGC2237|MGC2452|NR1C1|PPAR|hPPAR |
| Gene description: | peroxisome proliferator-activated receptor alpha |
| Genbank accession: | NM_001001928 |
| Immunogen: | PPARA (NP_001001928.1, 1 a.a. ~ 468 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY |
| Protein accession: | NP_001001928.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | PPARA MaxPab rabbit polyclonal antibody. Western Blot analysis of PPARA expression in Jurkat. |
| Applications: | WB-Ce,WB-Tr |
| Shipping condition: | Dry Ice |