Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of POU5F1 monoclonal antibody (M05), clone 1B11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,ELISA,WB-Re,WB-Tr,IF-CTC |
More info about POU5F1 monoclonal antibody (M05), clone 1B11
| Brand: | Abnova |
| Reference: | H00005460-M05 |
| Product name: | POU5F1 monoclonal antibody (M05), clone 1B11 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant POU5F1. |
| Clone: | 1B11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5460 |
| Gene name: | POU5F1 |
| Gene alias: | MGC22487|OCT3|OCT4|OTF3|OTF4 |
| Gene description: | POU class 5 homeobox 1 |
| Genbank accession: | BC020712 |
| Immunogen: | POU5F1 (AAH20712, 81 a.a. ~ 164 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | WFCNRRQKGKRSSSDYAQREDFEAAGSPFSGGPVSFPLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSVTTLGSPMHSN |
| Protein accession: | AAH20712 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.24 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | POU5F1 monoclonal antibody (M05), clone 1B11 Western Blot analysis of POU5F1 expression in HepG2 ( Cat # L019V1 ). |
| Applications: | WB-Ce,IF,ELISA,WB-Re,WB-Tr,IF-CTC |
| Shipping condition: | Dry Ice |
| Publications: | Physiologic Oxygen Concentration Enhances the Stem-Like Properties of CD133+ Human Glioblastoma Cells In vitro.McCord AM, Jamal M, Shankavarum UT, Lang FF, Camphausen K, Tofilon PJ. Mol Cancer Res. 2009 Apr;7(4):489-97. |