| Brand: | Abnova |
| Reference: | H00005459-M01 |
| Product name: | POU4F3 monoclonal antibody (M01), clone 5B8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant POU4F3. |
| Clone: | 5B8 |
| Isotype: | IgG1 Kappa |
| Gene id: | 5459 |
| Gene name: | POU4F3 |
| Gene alias: | BRN3C|DFNA15|MGC138412 |
| Gene description: | POU class 4 homeobox 3 |
| Genbank accession: | NM_002700 |
| Immunogen: | POU4F3 (NP_002691, 100 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PAALTSHPHHAVHQGLEGDLLEHISPTLSVSGLGAPEHSVMPAQIHPHHLGAMGHLHQAMGMSHPHTVAPHSAMPACLSDVESDPRELEAF |
| Protein accession: | NP_002691 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.75 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to POU4F3 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |