Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of POU4F3 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about POU4F3 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00005459-A01 |
| Product name: | POU4F3 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant POU4F3. |
| Gene id: | 5459 |
| Gene name: | POU4F3 |
| Gene alias: | BRN3C|DFNA15|MGC138412 |
| Gene description: | POU class 4 homeobox 3 |
| Genbank accession: | NM_002700 |
| Immunogen: | POU4F3 (NP_002691, 100 a.a. ~ 190 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | PAALTSHPHHAVHQGLEGDLLEHISPTLSVSGLGAPEHSVMPAQIHPHHLGAMGHLHQAMGMSHPHTVAPHSAMPACLSDVESDPRELEAF |
| Protein accession: | NP_002691 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |
| Publications: | Human Fetal Auditory Stem Cells Can Be Expanded In Vitro and Differentiate Into Functional Auditory Neurons and Hair Cell-Like Cells.Chen W, Johnson SL, Marcotti W, Andrews PW, Moore HD, Rivolta MN. Stem Cells. 2009 May;27(5):1196-204. |