| Brand: | Abnova |
| Reference: | H00005454-M01 |
| Product name: | POU3F2 monoclonal antibody (M01), clone 6F6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant POU3F2. |
| Clone: | 6F6 |
| Isotype: | IgG2b Kappa |
| Gene id: | 5454 |
| Gene name: | POU3F2 |
| Gene alias: | BRN2|OCT7|OTF7|POUF3 |
| Gene description: | POU class 3 homeobox 2 |
| Genbank accession: | NM_005604 |
| Immunogen: | POU3F2 (NP_005595, 1 a.a. ~ 67 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MATAASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHPLSHAHQWITALSH |
| Protein accession: | NP_005595 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | POU3F2 monoclonal antibody (M01), clone 6F6. Western Blot analysis of POU3F2 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Allele-specific silencing of mutant huntingtin and ataxin-3 genes by targeting expanded CAG repeats in mRNAs.Hu J, Matsui M, Gagnon KT, Schwartz JC, Gabillet S, Arar K, Wu J, Bezprozvanny I, Corey DR. Nat Biotechnol. 2009 May;27(5):478-84. Epub 2009 May 3. |