No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Rabbit |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00005441-D01P |
Product name: | POLR2L purified MaxPab rabbit polyclonal antibody (D01P) |
Product description: | Rabbit polyclonal antibody raised against a full-length human POLR2L protein. |
Gene id: | 5441 |
Gene name: | POLR2L |
Gene alias: | RBP10|RPABC5|RPB10|RPB10beta|RPB7.6|hRPB7.6|hsRPB10b |
Gene description: | polymerase (RNA) II (DNA directed) polypeptide L, 7.6kDa |
Genbank accession: | NM_021128.3 |
Immunogen: | POLR2L (NP_066951.1, 1 a.a. ~ 67 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK |
Protein accession: | NP_066951.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of POLR2L expression in transfected 293T cell line (H00005441-T04) by POLR2L MaxPab polyclonal antibody. Lane 1: POLR2L transfected lysate(7.60 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |