| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00005439-M02 |
| Product name: | POLR2J monoclonal antibody (M02), clone 1A10 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant POLR2J. |
| Clone: | 1A10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 5439 |
| Gene name: | POLR2J |
| Gene alias: | MGC71910|POLR2J1|RPB11|RPB11A|RPB11m|hRPB14 |
| Gene description: | polymerase (RNA) II (DNA directed) polypeptide J, 13.3kDa |
| Genbank accession: | BC024165 |
| Immunogen: | POLR2J (AAH24165, 1 a.a. ~ 117 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE |
| Protein accession: | AAH24165 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.61 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of POLR2J expression in transfected 293T cell line by POLR2J monoclonal antibody (M02), clone 1A10. Lane 1: POLR2J transfected lysate(13.3 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |