| Brand: | Abnova |
| Reference: | H00005437-M01 |
| Product name: | POLR2H monoclonal antibody (M01), clone 3G6-1A4 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant POLR2H. |
| Clone: | 3G6-1A4 |
| Isotype: | IgG1 Kappa |
| Gene id: | 5437 |
| Gene name: | POLR2H |
| Gene alias: | RPABC3|RPB17|RPB8|hsRPB8 |
| Gene description: | polymerase (RNA) II (DNA directed) polypeptide H |
| Genbank accession: | BC000739 |
| Immunogen: | POLR2H (AAH00739, 1 a.a. ~ 150 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQGDANNLHGFEVDSRVYLLMKKLAF |
| Protein accession: | AAH00739 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (42.24 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | POLR2H monoclonal antibody (M01), clone 3G6-1A4 Western Blot analysis of POLR2H expression in Hela ( Cat # L013V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Examining the Complexity of Human RNA Polymerase Complexes using HaloTag Technology Coupled to Label Free Quantitative Proteomics.Daniels DL, Mendez J, Mosley AL, Ramisetty SR, Murphy N, Benink H, Wood KV, Urh M, Washburn MP. J Proteome Res. 2012 Jan 3. |