| Brand: | Abnova |
| Reference: | H00005435-M02 |
| Product name: | POLR2F monoclonal antibody (M02), clone 2G2 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant POLR2F. |
| Clone: | 2G2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5435 |
| Gene name: | POLR2F |
| Gene alias: | HRBP14.4|POLRF|RPABC2|RPB14.4|RPB6 |
| Gene description: | polymerase (RNA) II (DNA directed) polypeptide F |
| Genbank accession: | NM_021974.2 |
| Immunogen: | POLR2F (NP_068809.1, 1 a.a. ~ 127 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITD |
| Protein accession: | NP_068809.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (40.9 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged POLR2F is 0.3 ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |