Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of POLR2D monoclonal antibody (M01), clone 1E4-A5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about POLR2D monoclonal antibody (M01), clone 1E4-A5
| Brand: | Abnova |
| Reference: | H00005433-M01 |
| Product name: | POLR2D monoclonal antibody (M01), clone 1E4-A5 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant POLR2D. |
| Clone: | 1E4-A5 |
| Isotype: | IgG1 kappa |
| Gene id: | 5433 |
| Gene name: | POLR2D |
| Gene alias: | HSRBP4|HSRPB4|RBP4 |
| Gene description: | polymerase (RNA) II (DNA directed) polypeptide D |
| Genbank accession: | BC017205 |
| Immunogen: | POLR2D (AAH17205, 1 a.a. ~ 142 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAAGGSDPRAGDVEEDASQLIFPKGFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY |
| Protein accession: | AAH17205 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (41.36 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of POLR2D expression in transfected 293T cell line by POLR2D monoclonal antibody (M01), clone 1E4-A5. Lane 1: POLR2D transfected lysate(16.3 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |