| Brand: | Abnova |
| Reference: | H00005412-M05 |
| Product name: | UBL3 monoclonal antibody (M05), clone 3A8 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant UBL3. |
| Clone: | 3A8 |
| Isotype: | IgG1 Kappa |
| Gene id: | 5412 |
| Gene name: | UBL3 |
| Gene alias: | DKFZp434K151|FLJ32018|HCG-1|PNSC1 |
| Gene description: | ubiquitin-like 3 |
| Genbank accession: | BC059385 |
| Immunogen: | UBL3 (AAH59385, 1 a.a. ~ 117 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSSNVPADMINLRLILVSGKTKEFLFSPNDSASDIAKHVYDNWPMDWEEEQVSSPNILRLIYQGRFLHGNVTLGALKLPFGKTTVMHLVARETLPEPNSQGQRNREKTGESNCCVIL |
| Protein accession: | AAH59385 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.61 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged UBL3 is approximately 1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |