Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PNMT monoclonal antibody (M06), clone 3G4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,IP |
More info about PNMT monoclonal antibody (M06), clone 3G4
| Brand: | Abnova |
| Reference: | H00005409-M06 |
| Product name: | PNMT monoclonal antibody (M06), clone 3G4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PNMT. |
| Clone: | 3G4 |
| Isotype: | IgG2b Kappa |
| Gene id: | 5409 |
| Gene name: | PNMT |
| Gene alias: | MGC34570|PENT|PNMTase |
| Gene description: | phenylethanolamine N-methyltransferase |
| Genbank accession: | NM_002686 |
| Immunogen: | PNMT (NP_002677, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSGADRSPNAGAAPDSAPGQAAVASAYQRFEPRAYLRNNYAPPRGDLCNPNGVGPWKLRCLAQTFATGEVSGRTLIDIGSGPTVYQLLSACSHFEDITMTDFLEVNRQEL |
| Protein accession: | NP_002677 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoprecipitation of PNMT transfected lysate using anti-PNMT monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with PNMT MaxPab rabbit polyclonal antibody. |
| Applications: | ELISA,IP |
| Shipping condition: | Dry Ice |