Product successfully added to your shopping cart
Quantity
Total
There are 3 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 949,21 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 949,21 €
Data sheet of PMS1 monoclonal antibody (M01), clone 2G10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about PMS1 monoclonal antibody (M01), clone 2G10
| Brand: | Abnova |
| Reference: | H00005378-M01 |
| Product name: | PMS1 monoclonal antibody (M01), clone 2G10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PMS1. |
| Clone: | 2G10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 5378 |
| Gene name: | PMS1 |
| Gene alias: | DKFZp781M0253|FLJ98259|HNPCC3|PMSL1|hPMS1 |
| Gene description: | PMS1 postmeiotic segregation increased 1 (S. cerevisiae) |
| Genbank accession: | NM_000534 |
| Immunogen: | PMS1 (NP_000525, 26 a.a. ~ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KELIENSLDAGATSVDVKLENYGFDKIEVRDNGEGIKAVDAPVMAMKYYTSKINSHEDLENLTTYGFRGEALGSICCIAEVLITTRTAADNFSTQYVLDGSGHILSQKPS |
| Protein accession: | NP_000525 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged PMS1 is approximately 0.03ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |