No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
| Brand: | Abnova |
| Reference: | H00005376-M10 |
| Product name: | PMP22 monoclonal antibody (M10), clone 3G10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PMP22. |
| Clone: | 3G10 |
| Isotype: | IgG2b Kappa |
| Gene id: | 5376 |
| Gene name: | PMP22 |
| Gene alias: | CMT1A|CMT1E|DSS|GAS-3|HMSNIA|HNPP|MGC20769|Sp110 |
| Gene description: | peripheral myelin protein 22 |
| Genbank accession: | BC019040 |
| Immunogen: | PMP22 (AAH19040, 25 a.a. ~ 114 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VSQWIVGNGHATDLWQNCSTSSSGNVHHCFSSSPNEWLQSVQATMILSIIFSILSLFLFFCQLFTLTKGGRFYITGIFQILAGLCVMSAA |
| Protein accession: | AAH19040 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | http://www.abnova.com/application_image/ |
| Application image note: | Detection limit for recombinant GST tagged PMP22 is approximately 30ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |