No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA |
Brand: | Abnova |
Reference: | H00005376-M10 |
Product name: | PMP22 monoclonal antibody (M10), clone 3G10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PMP22. |
Clone: | 3G10 |
Isotype: | IgG2b Kappa |
Gene id: | 5376 |
Gene name: | PMP22 |
Gene alias: | CMT1A|CMT1E|DSS|GAS-3|HMSNIA|HNPP|MGC20769|Sp110 |
Gene description: | peripheral myelin protein 22 |
Genbank accession: | BC019040 |
Immunogen: | PMP22 (AAH19040, 25 a.a. ~ 114 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VSQWIVGNGHATDLWQNCSTSSSGNVHHCFSSSPNEWLQSVQATMILSIIFSILSLFLFFCQLFTLTKGGRFYITGIFQILAGLCVMSAA |
Protein accession: | AAH19040 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | http://www.abnova.com/application_image/ |
Application image note: | Detection limit for recombinant GST tagged PMP22 is approximately 30ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |