Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PMM2 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about PMM2 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00005373-A01 |
| Product name: | PMM2 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant PMM2. |
| Gene id: | 5373 |
| Gene name: | PMM2 |
| Gene alias: | CDG1|CDG1a|CDGS |
| Gene description: | phosphomannomutase 2 |
| Genbank accession: | NM_000303 |
| Immunogen: | PMM2 (NP_000294, 47 a.a. ~ 111 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | SDFEKVQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIK |
| Protein accession: | NP_000294 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (33.26 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PMM2 polyclonal antibody (A01), Lot # 051219JC01 Western Blot analysis of PMM2 expression in HL-60 ( Cat # L014V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Pharmacological Chaperoning: A Potential Treatment For PMM2-CDG.Yuste-Checa P, Brasil S, Gamez A, Underhaug J, Desviat LR, Ugarte M, Perez-Cerda C, Martinez A, Perez B. Hum Mutat. 2016 Oct 24. [Epub ahead of print] |