Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PML monoclonal antibody (M04), clone 2B10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA |
More info about PML monoclonal antibody (M04), clone 2B10
| Brand: | Abnova |
| Reference: | H00005371-M04 |
| Product name: | PML monoclonal antibody (M04), clone 2B10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PML. |
| Clone: | 2B10 |
| Isotype: | IgG1 Kappa |
| Gene id: | 5371 |
| Gene name: | PML |
| Gene alias: | MYL|PP8675|RNF71|TRIM19 |
| Gene description: | promyelocytic leukemia |
| Genbank accession: | BC000080 |
| Immunogen: | PML (AAH00080, 411 a.a. ~ 510 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RDPIDVDLDVSNTTTAQKRKCSQTQCPRKVIKMESEEGKEARLARSSPEQPRPSTSKAVSPPHLDGPPSPRSPVIGSEVFLPNSNHVASGAGEAEERVVV |
| Protein accession: | AAH00080 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PML monoclonal antibody (M04), clone 2B10. Western Blot analysis of PML expression in HepG2(Cat # L019V1 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |