No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00005368-M01 |
Product name: | PNOC monoclonal antibody (M01), clone 4F6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PNOC. |
Clone: | 4F6 |
Isotype: | IgG2a |
Gene id: | 5368 |
Gene name: | PNOC |
Gene alias: | PPNOC |
Gene description: | prepronociceptin |
Genbank accession: | NM_006228.3 |
Immunogen: | PNOC (NP_006219.1, 96 a.a. ~ 168 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | RRMPRVRSLFQEQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQYLVLSMQSSQRRR |
Protein accession: | NP_006219.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (33.66 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | PNOC monoclonal antibody (M01), clone 4F6. Western Blot analysis of PNOC expression in K-562. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |