Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PLXNA2 monoclonal antibody (M06), clone 2G5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about PLXNA2 monoclonal antibody (M06), clone 2G5
| Brand: | Abnova |
| Reference: | H00005362-M06 |
| Product name: | PLXNA2 monoclonal antibody (M06), clone 2G5 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant PLXNA2. |
| Clone: | 2G5 |
| Isotype: | IgG2b Kappa |
| Gene id: | 5362 |
| Gene name: | PLXNA2 |
| Gene alias: | FLJ11751|FLJ30634|KIAA0463|OCT|PLXN2 |
| Gene description: | plexin A2 |
| Genbank accession: | BC032125 |
| Immunogen: | PLXNA2 (AAH32125, 1 a.a. ~ 164 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MHSQVFSAFPYSLPLRFWVNVIKNPQFVFDIHKGSITDACLSVVAQTFMDSCSTSEHRLDKDSPSNKLLYAKDIPSYKSWVERYYADIAKLPAISDQDMNAYLAEQSRLHAVEFNMLSALNEIYSYVSKYSEELIGALEQDEQARRQRLAYKVEQLINAMSIES |
| Protein accession: | AAH32125 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (43.78 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | PLXNA2 monoclonal antibody (M06), clone 2G5. Western Blot analysis of PLXNA2 expression in HepG2(Cat # L019V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |