Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PLS1 monoclonal antibody (M04), clone 3G10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about PLS1 monoclonal antibody (M04), clone 3G10
| Brand: | Abnova |
| Reference: | H00005357-M04 |
| Product name: | PLS1 monoclonal antibody (M04), clone 3G10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PLS1. |
| Clone: | 3G10 |
| Isotype: | IgG2b Kappa |
| Gene id: | 5357 |
| Gene name: | PLS1 |
| Gene alias: | I-PLASTIN |
| Gene description: | plastin 1 (I isoform) |
| Genbank accession: | NM_002670 |
| Immunogen: | PLS1 (NP_002661.1, 1 a.a. ~ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MENSTTTISREELEELQEAFNKIDIDNSGYVSDYELQDLFKEASLPLPGYKVREIVEKILSVADSNKDGKISFEEFVSLMQELKSKDISKTFRKIINKREGI |
| Protein accession: | NP_002661.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.96 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PLS1 monoclonal antibody (M04), clone 3G10. Western Blot analysis of PLS1 expression in Jurkat ( Cat # L017V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Plastin 1 widens stereocilia by transforming actin filament packing from hexagonal to liquid.Krey JF, Krystofiak ES, Dumont RA, Vijayakumar S, Choi D, Rivero F, Kachar B, Jones SM, Barr-Gillespie PG. J Cell Biol. 2016 Nov 21;215(4):467-482. Epub 2016 Nov 3. |