View larger

FXYD3 purified MaxPab mouse polyclonal antibody (B01P)

Reference:

Condition: New product

Data sheet of FXYD3 purified MaxPab mouse polyclonal antibody (B01P)

Brand:	Abnova
Reference:	H00005349-B01P
Product name:	FXYD3 purified MaxPab mouse polyclonal antibody (B01P)
Product description:	Mouse polyclonal antibody raised against a full-length human FXYD3 protein.
Gene id:	5349
Gene name:	FXYD3
Gene alias:	MAT-8\|MAT8\|MGC111076\|PLML
Gene description:	FXYD domain containing ion transport regulator 3
Genbank accession:	BC005238
Immunogen:	FXYD3 (AAH05238, 21 a.a. ~ 87 a.a) full-length human protein.
Immunogen sequence/protein sequence:	NDLEDKNSPFYYDWHSLQVGGLICAGVLCAMGIIIVMSAKCKCKFGQKSGHHPGETPPLITPGSAQS
Protein accession:	AAH05238
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody reactive against mammalian transfected lysate.
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Western Blot analysis of FXYD3 expression in transfected 293T cell line (H00005349-T01) by FXYD3 MaxPab polyclonal antibody. Lane 1: FXYD3 transfected lysate(9.68 KDa). Lane 2: Non-transfected lysate.
Applications:	WB-Tr
Shipping condition:	Dry Ice