No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00005341-M03 |
| Product name: | PLEK monoclonal antibody (M03), clone 2D8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PLEK. |
| Clone: | 2D8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5341 |
| Gene name: | PLEK |
| Gene alias: | FLJ27168|P47 |
| Gene description: | pleckstrin |
| Genbank accession: | BC018549 |
| Immunogen: | PLEK (AAH18549, 121 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PETIDLGALYLSMKDTEKGIKELNLEKDKKIFNHCFTGNCVIDWLVSNQSVRNRQEGLMIASSLLNEGYLQPAGDMSKSAVDGTAENPFLDNPDAFYYFPDSGFFCEENS |
| Protein accession: | AAH18549 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | PLEK monoclonal antibody (M03), clone 2D8. Western Blot analysis of PLEK expression in HL-60 ( Cat # L014V1 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |