No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00005341-A01 |
Product name: | PLEK polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant PLEK. |
Gene id: | 5341 |
Gene name: | PLEK |
Gene alias: | FLJ27168|P47 |
Gene description: | pleckstrin |
Genbank accession: | BC018549 |
Immunogen: | PLEK (AAH18549, 121 a.a. ~ 230 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | PETIDLGALYLSMKDTEKGIKELNLEKDKKIFNHCFTGNCVIDWLVSNQSVRNRQEGLMIASSLLNEGYLQPAGDMSKSAVDGTAENPFLDNPDAFYYFPDSGFFCEENS |
Protein accession: | AAH18549 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | PLEK polyclonal antibody (A01), Lot # 060814QCS1 Western Blot analysis of PLEK expression in THP-1 ( Cat # L007V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |