No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00005339-M03 |
Product name: | PLEC1 monoclonal antibody (M03), clone 4C3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PLEC1. |
Clone: | 4C3 |
Isotype: | IgG2a Kappa |
Gene id: | 5339 |
Gene name: | PLEC1 |
Gene alias: | EBS1|EBSO|HD1|PCN|PLEC1b|PLTN |
Gene description: | plectin 1, intermediate filament binding protein 500kDa |
Genbank accession: | NM_000445 |
Immunogen: | PLEC1 (NP_000436, 4384 a.a. ~ 4493 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | CGFEDPRTKTKMSAAQALKKGWLYYEAGQRFLEVQYLTGGLIEPDTPGRVPLDEALQRGTVDARTAQKLRDVGAYSKYLTCPKTKLKISYKDALDRSMVEEGTGLRLLEA |
Protein accession: | NP_000436 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged PLEC1 is 0.1 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |