| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00005337-M01 |
| Product name: | PLD1 monoclonal antibody (M01), clone 2F3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PLD1. |
| Clone: | 2F3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 5337 |
| Gene name: | PLD1 |
| Gene alias: | - |
| Gene description: | phospholipase D1, phosphatidylcholine-specific |
| Genbank accession: | NM_002662 |
| Immunogen: | PLD1 (NP_002653, 965 a.a. ~ 1074 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GYLDDPSEDIQDPVSDKFFKEVWVSTAARNATIYDKVFRCLPNDEVHNLIQLRDFINKPVLAKEDPIRAEEELKKIRGFLVQFPFYFLSEESLLPSVGTKEAIVPMEVWT |
| Protein accession: | NP_002653 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of PLD1 expression in transfected 293T cell line by PLD1 monoclonal antibody (M01), clone 2F3. Lane 1: PLD1 transfected lysate(124.2 KDa). Lane 2: Non-transfected lysate. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Mechanisms for the activity of heterocyclic cyclohexanone curcumin derivatives in estrogen receptor negative human breast cancer cell lines.Somers-Edgar TJ, Taurin S, Larsen L, Chandramouli A, Nelson MA, Rosengren RJ. Invest New Drugs. 2009 Oct 9. [Epub ahead of print] |