Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PLAUR monoclonal antibody (M04), clone 1D6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about PLAUR monoclonal antibody (M04), clone 1D6
| Brand: | Abnova |
| Reference: | H00005329-M04 |
| Product name: | PLAUR monoclonal antibody (M04), clone 1D6 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant PLAUR. |
| Clone: | 1D6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5329 |
| Gene name: | PLAUR |
| Gene alias: | CD87|UPAR|URKR |
| Gene description: | plasminogen activator, urokinase receptor |
| Genbank accession: | BC002788 |
| Immunogen: | PLAUR (AAH02788, 1 a.a. ~ 335 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT |
| Protein accession: | AAH02788 |
| Storage buffer: | In 1x PBS, pH 7.2 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (62.59 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of PLAUR expression in transfected 293T cell line by PLAUR monoclonal antibody (M04), clone 1D6. Lane 1: PLAUR transfected lysate (Predicted MW: 37 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |