No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Brand: | Abnova |
Reference: | H00005329-A02 |
Product name: | PLAUR polyclonal antibody (A02) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant PLAUR. |
Gene id: | 5329 |
Gene name: | PLAUR |
Gene alias: | CD87|UPAR|URKR |
Gene description: | plasminogen activator, urokinase receptor |
Genbank accession: | NM_001005377 |
Immunogen: | PLAUR (NP_001005377, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | NGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERG |
Protein accession: | NP_001005377 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Shipping condition: | Dry Ice |