> >>PLAUR polyclonal antibody (A02)
PLAUR polyclonal antibody (A02) View larger

PLAUR polyclonal antibody (A02)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language
Rate it

Data sheet of PLAUR polyclonal antibody (A02)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse

More info about PLAUR polyclonal antibody (A02)

Brand: Abnova
Reference: H00005329-A02
Product name: PLAUR polyclonal antibody (A02)
Product description: Mouse polyclonal antibody raised against a partial recombinant PLAUR.
Gene id: 5329
Gene name: PLAUR
Gene alias: CD87|UPAR|URKR
Gene description: plasminogen activator, urokinase receptor
Genbank accession: NM_001005377
Immunogen: PLAUR (NP_001005377, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: NGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERG
Protein accession: NP_001005377
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005329-A02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Shipping condition: Dry Ice

Reviews

Buy PLAUR polyclonal antibody (A02) now

Add to cart