| Brand: | Abnova |
| Reference: | H00005319-M01 |
| Product name: | PLA2G1B monoclonal antibody (M01), clone 1B3 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant PLA2G1B. |
| Clone: | 1B3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5319 |
| Gene name: | PLA2G1B |
| Gene alias: | MGC119834|MGC119835|PLA2|PLA2A|PPLA2 |
| Gene description: | phospholipase A2, group IB (pancreas) |
| Genbank accession: | BC005386 |
| Immunogen: | PLA2G1B (AAH05386, 17 a.a. ~ 70 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKQKQRV |
| Protein accession: | AAH05386 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (31.68 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged PLA2G1B is approximately 0.3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |