| Brand: | Abnova |
| Reference: | H00005316-M04 |
| Product name: | PKNOX1 monoclonal antibody (M04), clone 3C5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PKNOX1. |
| Clone: | 3C5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5316 |
| Gene name: | PKNOX1 |
| Gene alias: | PREP1|pkonx1c |
| Gene description: | PBX/knotted 1 homeobox 1 |
| Genbank accession: | NM_004571 |
| Immunogen: | PKNOX1 (NP_004562, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MATQTLSIDSYQDGQQMQVVTELKTEQDPNCSEPDAEGVSPPPVESQTPMDVDKQAIYRHPLFPLLALLFEKCEQSTQGSEGTTSASFDVDIENFVRKQ |
| Protein accession: | NP_004562 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PKNOX1 monoclonal antibody (M04), clone 3C5 Western Blot analysis of PKNOX1 expression in IMR-32 ( Cat # L008V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |