| Brand: | Abnova |
| Reference: | H00005313-M03 |
| Product name: | PKLR monoclonal antibody (M03), clone 4A8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PKLR. |
| Clone: | 4A8 |
| Isotype: | IgG2b Kappa |
| Gene id: | 5313 |
| Gene name: | PKLR |
| Gene alias: | PK1|PKL|PKR|PKRL|RPK |
| Gene description: | pyruvate kinase, liver and RBC |
| Genbank accession: | BC025737 |
| Immunogen: | PKLR (AAH25737, 485 a.a. ~ 574 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SRYRPRAAVIAVTRSAQAARQVHLCRGVFPLLYREPPEAIWADDVDRRVQFGIESGKLRGFLRVGDLVIVVTGWRPGSGYTNIMRVLSIS |
| Protein accession: | AAH25737 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to PKLR on HeLa cell . [antibody concentration 10 ug/ml] |
| Applications: | IF,ELISA |
| Shipping condition: | Dry Ice |