Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PITX2 polyclonal antibody (A03)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about PITX2 polyclonal antibody (A03)
| Brand: | Abnova |
| Reference: | H00005308-A03 |
| Product name: | PITX2 polyclonal antibody (A03) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant PITX2. |
| Gene id: | 5308 |
| Gene name: | PITX2 |
| Gene alias: | ARP1|Brx1|IDG2|IGDS|IGDS2|IHG2|IRID2|MGC111022|MGC20144|Otlx2|PTX2|RGS|RIEG|RIEG1|RS |
| Gene description: | paired-like homeodomain 2 |
| Genbank accession: | NM_153427 |
| Immunogen: | PITX2 (NP_700476, 189 a.a. ~ 270 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | PGSSLNSLNNLNNLSSPSLNSAVPTPACPYAPPTPPYVYRDTCNSSLASLRLKAKQHSSFGYASVQNPASNLSACQYAVDRP |
| Protein accession: | NP_700476 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.13 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |