| Brand: | Abnova |
| Reference: | H00005307-M02 |
| Product name: | PITX1 monoclonal antibody (M02), clone 6D4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PITX1. |
| Clone: | 6D4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5307 |
| Gene name: | PITX1 |
| Gene alias: | BFT|POTX|PTX1 |
| Gene description: | paired-like homeodomain 1 |
| Genbank accession: | NM_002653 |
| Immunogen: | PITX1 (NP_002644, 225 a.a. ~ 313 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGLQGPASGLNACQYN |
| Protein accession: | NP_002644 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PITX1 monoclonal antibody (M02), clone 6D4 Western Blot analysis of PITX1 expression in A-431 ( Cat # L015V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | The c-Abl tyrosine kinase stabilizes Pitx1 in the apoptotic response to DNA damage.Yamaguchi T, Miki Y, Yoshida K. Apoptosis. 2010 Aug;15(8):927-35. |